PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_13788_iso_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 341aa    MW: 37327.1 Da    PI: 8.6858
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_13788_iso_3genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.73.6e-201459147
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                          +g+W++eEdell ++v+++G+++W++I++ ++ gR++k+c++rw + 
  cra_locus_13788_iso_3_len_1496_ver_3 14 KGPWSPEEDELLQRLVEKHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 59
                                          79******************************.***********985 PP

2Myb_DNA-binding57.23.7e-1868110347
                                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                       Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                           ++T+eEde +++a++++G++ W+tIar +  gRt++ +k++w++ 
  cra_locus_13788_iso_3_len_1496_ver_3  68 AFTPEEDETIIKAHAKFGNK-WATIARLLS-GRTDNAIKNHWNST 110
                                           79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.726964IPR017930Myb domain
SuperFamilySSF466891.69E-3211107IPR009057Homeodomain-like
SMARTSM007172.5E-181362IPR001005SANT/Myb domain
PfamPF002495.9E-201459IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-271567IPR009057Homeodomain-like
CDDcd001671.64E-171658No hitNo description
SMARTSM007172.7E-1565113IPR001005SANT/Myb domain
PROSITE profilePS5129421.74166115IPR017930Myb domain
CDDcd001671.65E-1268111No hitNo description
Gene3DG3DSA:1.10.10.601.4E-2368114IPR009057Homeodomain-like
PfamPF002493.1E-1568110IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MGTIAQRKDT DRIKGPWSPE EDELLQRLVE KHGPRNWSLI SKSIPGRSGK SCRLRWCNQL  60
SPQVEHRAFT PEEDETIIKA HAKFGNKWAT IARLLSGRTD NAIKNHWNST LKRRCSSMSD  120
DFNFEIPQQP LKRSNSVXAG YKCFCLYFNP SSPSGSELSE SSLSGFGSTH VFRPLARAGG  180
ISPPAQHIET PPSVPDPPTF LTLSLPGSES GKTQAQKIGS GDEHTPVFSS GPTVQQPLQV  240
ETTAAAAQVA PAPAVPPQTA APALEWPAGF GFGMPASMEA PGQEKQFFSQ EFLAVLQDMI  300
RKEMRNYMSM SGLDQNGLCK CMQTDAIRNA VVKRIGISKI D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-40131143104C-Myb DNA-Binding Domain
1msf_C2e-40131143104C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015884347.11e-134PREDICTED: transcription factor MYB44-like
TrEMBLA0A068TZ171e-141A0A068TZ17_COFCA; Uncharacterized protein
STRINGSolyc04g078420.1.11e-130(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15862471